![PerCP Anti-Human CD3 Antibody [UCHT1] - E-AB-F1230F Size:20 Tests No significant cross-reactivity or interference](https://cdn.shopify.com/s/files/1/0305/9482/6376/products/logo_new_e9068a8e-0e31-46b6-90d0-8af03aa23ee6.png?v=1710508424){kind=logo}
Pay in 4 interest-free payments of $35.70 Learn more
Ships within 48 hours · Estimated delivery Jul 27 - Aug 1
No significant cross-reactivity or interference between Human OCLN and analogues was observed
including two hnRNPK homology (KH) domains and an RGG amino acid motif (RGG box)
Sequence: MMVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD Purity: > 98 % as determined by reducing SDS-PAGE
may mediate increasd glucose uptake in response to neuronal injury
No significant cross-reactivity or interference between Human CK-19/KRT19 and analogues was observed
PerCP Anti-Human CD3 Antibody [UCHT1] - E-AB-F1230F Size:20 Tests No significant cross-reactivity or interferencePerCP Anti Human CD3 Antibody [UCHT1] Sizes: 20 Tests, 100 Tests, 100 Tests2 Catalogue Numbers: E AB F1230F 20, E AB F1230F 100, E AB F1230F 1002 Citations, Manuals and MSDS Available upon request. Abbreviation: CD3 Target Synonym: T cell surface glycoprotein CD3 epsilon chain, CD3E, T cell surface antigen T3 Leu 4 epsilon chain, CD3e, CD3E, T3E, Conjugation: PerCP Host: Mouse Species Reactivity: Human Application: FCM Usage: Each lot of this antibody
US$ 37.95
US$ 85.00
US$ 136.00
US$ 47.95
US$ 150.00
US$ 52.95
US$ 89.95
US$ 89.95